PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S03878.20
Common NameJCGZ_13664, LOC105639066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family SRS
Protein Properties Length: 348aa    MW: 37011.6 Da    PI: 7.5623
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S03878.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702227.91.9e-701192683154
         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaesk 97 
                    +g++sCqdCGnqakkdC+h+RCRtCCksrgfdC+thvkstWvpa+krrerqq +a ++++++ +   ++++kr+re+   ++s+l++t+l+s++++
  Jcr4S03878.20 119 AGGMSCQDCGNQAKKDCMHMRCRTCCKSRGFDCQTHVKSTWVPASKRRERQQLAALQQQQQQLQLrGDQNPKRHREN--PTSSSLACTRLPSNNTT 212
                    6899**********************************************988887776666655356666777765..889999*****999765 PP

         DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      l++ ++P+evss+a frcvrvs++d++++++aYqtav+igGhvfkGiLyd+G e+
  Jcr4S03878.20 213 -GLDVGNFPAEVSSPATFRCVRVSGIDENDDQYAYQTAVNIGGHVFKGILYDHGSES 268
                    .99***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.8E-67121267IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.1E-28123165IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.9E-27219265IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAGLFSLGGG GGGGGRGSNQ DDQHNNNPPT EIPQESWFWY KNEDIPYKGT TFELWQQQEF  60
LHHRHHQHHH QNQDLYSSAA GLGVGPSRSS INVSDESSSR SAFMMMRSVS GAGGGSGGAG  120
GMSCQDCGNQ AKKDCMHMRC RTCCKSRGFD CQTHVKSTWV PASKRRERQQ LAALQQQQQQ  180
LQLRGDQNPK RHRENPTSSS LACTRLPSNN TTGLDVGNFP AEVSSPATFR CVRVSGIDEN  240
DDQYAYQTAV NIGGHVFKGI LYDHGSESSY IPAGESSSGG GSVGVQPLNL ITAGTVSASS  300
VAISPTAGGG GVTSASSSAA AFMDASSLYP TPLNTFIAGT QFFPNPRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078391.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9SD401e-113SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A067K8V20.0A0A067K8V2_JATCU; Uncharacterized protein
STRINGPOPTR_0007s13610.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-90Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]